PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10000491m
Common NameCICLE_v10000491mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ARF
Protein Properties Length: 683aa    MW: 75901.4 Da    PI: 6.2389
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10000491mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B371.21.3e-22131232199
                      EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgr 87 
                      f+k+lt sd++++g +++ +++a+++       +++    ++l+ +d++g++W +++i+r++++r++lt+GW+ Fv++++L +gD ++F   + 
  Ciclev10000491m 131 FCKTLTASDTSTHGGFSVLRRHADDClppldmsQQP--PWQELVATDLHGNEWHFRHIFRGQPRRHLLTTGWSVFVSSKKLVAGDAFIFL--RG 220
                      99****************************964333..4459************************************************..34 PP

                      SEE..EEEEE-S CS
               B3  88 sefelvvkvfrk 99 
                      +++el+v+v+r+
  Ciclev10000491m 221 ENEELRVGVRRH 232
                      88889****996 PP

2Auxin_resp111.86.8e-37257339183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha++t++ F+++Y+Pr+s+seF+v+v+k+++a ++k+svGmRfkm fe+e+++err+sGt+vgv d+ ++ W++S+WrsLk
  Ciclev10000491m 257 ASHAIATGTLFSIFYKPRTSRSEFIVSVNKYLEAKRHKLSVGMRFKMTFEGEEVPERRFSGTIVGVGDCRSSVWQDSEWRSLK 339
                      789******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019363.79E-44121260IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.103.6E-41128246IPR015300DNA-binding pseudobarrel domain
CDDcd100172.42E-20129231No hitNo description
SMARTSM010193.1E-22131233IPR003340B3 DNA binding domain
PfamPF023621.9E-20131232IPR003340B3 DNA binding domain
PROSITE profilePS5086311.124131233IPR003340B3 DNA binding domain
PfamPF065071.1E-34257339IPR010525Auxin response factor
PfamPF023092.4E-12555648IPR033389AUX/IAA domain
PROSITE profilePS5174528.221558651IPR000270PB1 domain
SuperFamilySSF542776.15E-12560635No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010150Biological Processleaf senescence
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0042802Molecular Functionidentical protein binding
Sequence ? help Back to Top
Protein Sequence    Length: 683 aa     Download sequence    Send to blast
MAFAAAAAPL NHASGGPRTG GSNDALYREL WHACAGPLVT LPREGERVYY FPQGHMEQLE  60
ASMHQGLEQQ MPSFNLPSKI LCKVVNVQRR AEPETDEVYA QITLLPEPDQ SEVTSPDPPI  120
PEPEKCTVHS FCKTLTASDT STHGGFSVLR RHADDCLPPL DMSQQPPWQE LVATDLHGNE  180
WHFRHIFRGQ PRRHLLTTGW SVFVSSKKLV AGDAFIFLRG ENEELRVGVR RHMRQQTNMP  240
SSVISSHSMH LGVLATASHA IATGTLFSIF YKPRTSRSEF IVSVNKYLEA KRHKLSVGMR  300
FKMTFEGEEV PERRFSGTIV GVGDCRSSVW QDSEWRSLKV QWDEPSSILR PERVSSWELE  360
PLVATTTTTN AQPAQRNKRS RPPVLPSPAA DISVLGMWKS HVESSAFSYC DSPQGRDLYP  420
SPKFSTATKG NHFGLSGNKS LAAVSSNSMY WPNRAENVTE SFAPVVNKEC SEKRQGNGNT  480
CRLFGIQLVD NSNVEEASPA FTMSGAMGDD RAIPCLDADS DQHSEPSNIN RSDVPSVSCD  540
AEKSCLRSPQ ESQSRQIRSC TKVHMQGIAV GRAVDLTRFD CYEDLLKKLE EMFDIEGDLC  600
GSTKKWQVVY TDDEDDMMMV GDDPWHEFCS MVRKIFIYTA EEVKKLSPKV KLPGNEELNA  660
GKPDVEVVVN TDDRSSIVGP GC*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A0.083622355Auxin response factor 1
4ldw_A0.083622355Auxin response factor 1
4ldw_B0.083622355Auxin response factor 1
4ldx_A0.083622355Auxin response factor 1
4ldx_B0.083622355Auxin response factor 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00097PBMTransfer from AT1G59750Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006431443.10.0hypothetical protein CICLE_v10000491mg
SwissprotQ8L7G00.0ARFA_ARATH; Auxin response factor 1
TrEMBLV4SAY20.0V4SAY2_9R
STRINGVIT_12s0035g01800.t010.0(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM88252227
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G59750.40.0auxin response factor 1